Brand: | Abnova |
Reference: | P4534 |
Product name: | Csf1r (Mouse) Recombinant Protein |
Product description: | Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 12978 |
Gene name: | Csf1r |
Gene alias: | AI323359|CD115|CSF-1R|Csfmr|Fim-2|Fms|M-CSFR |
Gene description: | colony stimulating factor 1 receptor |
Genbank accession: | NM_001037859 |
Immunogen sequence/protein sequence: | ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD |
Protein accession: | NP_001032948.2 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
Quality control testing picture: | ![qc_test-P4534-1.jpg](http://www.abnova.com/qc_test_image/qc_test-P4534-1.jpg) |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Mouse |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |