View larger

ZNF544 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF544 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ZNF544 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00027300-P01
Product name: ZNF544 (Human) Recombinant Protein (P01)
Product description: Human ZNF544 full-length ORF ( ENSP00000329320, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 27300
Gene name: ZNF544
Gene alias: -
Gene description: zinc finger protein 544
Genbank accession: ENST00000333581
Immunogen sequence/protein sequence: MEARSMLVPPQASVCFEDVAMAFTQEEWEQLDLAQRTLYREVTLETWEHIVSLGLFLSKSDVISQLEQEEDLCRAEQEAPRGTSGLSQVTGVVADGSFRFPVWDFT
Protein accession: ENSP00000329320
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00027300-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF544 (Human) Recombinant Protein (P01) now

Add to cart