Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LCP1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Rabbit |
| Applications | WB,WB-Ce,IHC-P,IF |
More info about LCP1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31675 |
| Product name: | LCP1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human LCP1. |
| Isotype: | IgG |
| Gene id: | 3936 |
| Gene name: | LCP1 |
| Gene alias: | CP64|DKFZp781A23186|FLJ25423|FLJ26114|FLJ39956|L-PLASTIN|LC64P|LPL|PLS2 |
| Gene description: | lymphocyte cytosolic protein 1 (L-plastin) |
| Immunogen: | Recombinant protein corresponding to amino acids 18-77 of human LCP1. |
| Immunogen sequence/protein sequence: | FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI |
| Protein accession: | P13796 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (0.4 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments. Antibody staining is shown in green. |
| Applications: | WB,WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria.Bachmann J, Burte F, Pramana S, Conte I, Brown BJ, Orimadegun AE, Ajetunmobi WA, Afolabi NK, Akinkunmi F, Omokhodion S, Akinbami FO, Shokunbi WA, Kampf C, Pawitan Y, Uhlen M, Sodeinde O, Schwenk JM, Wahlgren M, Fernandez-Reyes D, Nilsson P. PLoS Pathog. 2014 Apr 17;10(4):e1004038. doi: 10.1371/journal.ppat.1004038. eCollection 2014 Apr. |