Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB-Ce,WB-Ti,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31618 |
Product name: | QKI polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human QKI. |
Isotype: | IgG |
Gene id: | 9444 |
Gene name: | QKI |
Gene alias: | DKFZp586I0923|Hqk|QK|QK1|QK3 |
Gene description: | quaking homolog, KH domain RNA binding (mouse) |
Immunogen: | Recombinant protein corresponding to amino acids 163-311 of human QKI. |
Immunogen sequence/protein sequence: | RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL |
Protein accession: | Q96PU8 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green. |
Applications: | WB-Ce,WB-Ti,IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | Expression of Quaking RNA-Binding Protein in the Adult and Developing Mouse Retina.Suiko T, Kobayashi K, Aono K, Kawashima T, Inoue K, Ku L, Feng Y, Koike C. PLoS One. 2016 May 19;11(5):e0156033. doi: 10.1371/journal.pone.0156033. eCollection 2016. |