Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31617 |
Product name: | THOC1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human THOC1. |
Isotype: | IgG |
Gene id: | 9984 |
Gene name: | THOC1 |
Gene alias: | HPR1|P84|P84N5 |
Gene description: | THO complex 1 |
Immunogen: | Recombinant protein corresponding to amino acids 154-240 of human THOC1. |
Immunogen sequence/protein sequence: | VFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS |
Protein accession: | Q96FV9 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | Differential expression of THOC1 and ALY mRNP biogenesis/export factors in human cancers.Dominguez-Sanchez MS, Saez C, Japon MA, Aguilera A, Luna R. BMC Cancer. 2011 Feb 17;11:77. doi: 10.1186/1471-2407-11-77. |