View larger

THOC1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of THOC1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about THOC1 polyclonal antibody

Brand: Abnova
Reference: PAB31617
Product name: THOC1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human THOC1.
Isotype: IgG
Gene id: 9984
Gene name: THOC1
Gene alias: HPR1|P84|P84N5
Gene description: THO complex 1
Immunogen: Recombinant protein corresponding to amino acids 154-240 of human THOC1.
Immunogen sequence/protein sequence: VFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS
Protein accession: Q96FV9
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31617-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice
Publications: Differential expression of THOC1 and ALY mRNP biogenesis/export factors in human cancers.Dominguez-Sanchez MS, Saez C, Japon MA, Aguilera A, Luna R.
BMC Cancer. 2011 Feb 17;11:77. doi: 10.1186/1471-2407-11-77.

Reviews

Buy THOC1 polyclonal antibody now

Add to cart