View larger

SERPINB5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SERPINB5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P,IF

More info about SERPINB5 polyclonal antibody

Brand: Abnova
Reference: PAB31614
Product name: SERPINB5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SERPINB5.
Isotype: IgG
Gene id: 5268
Gene name: SERPINB5
Gene alias: PI5|maspin
Gene description: serpin peptidase inhibitor, clade B (ovalbumin), member 5
Immunogen: Recombinant protein corresponding to amino acids 1-95 of human SERPINB5.
Immunogen sequence/protein sequence: MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVD
Protein accession: P36952
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: PAB31614-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.
Applications: WB,WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SERPINB5 polyclonal antibody now

Add to cart