View larger

FHIT polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FHIT polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about FHIT polyclonal antibody

Brand: Abnova
Reference: PAB31609
Product name: FHIT polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombiant human FHIT.
Isotype: IgG
Gene id: 2272
Gene name: FHIT
Gene alias: AP3Aase|FRA3B
Gene description: fragile histidine triad gene
Immunogen: Recombinant protein corresponding to human FHIT.
Immunogen sequence/protein sequence: GTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEA
Protein accession: P49789
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-500)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31609-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubules and weak staining in glomeruli.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FHIT polyclonal antibody now

Add to cart