View larger

FNTA polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FNTA polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about FNTA polyclonal antibody

Brand: Abnova
Reference: PAB31607
Product name: FNTA polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombiant human FNTA.
Isotype: IgG
Gene id: 2339
Gene name: FNTA
Gene alias: FPTA|MGC99680|PGGT1A|PTAR2
Gene description: farnesyltransferase, CAAX box, alpha
Immunogen: Recombinant protein corresponding to human FNTA.
Immunogen sequence/protein sequence: LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
Protein accession: P49354
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000)
Western Blot (1:100-250)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31607-48-33-1.jpg
Application image note: Immunohistochemical staining of human prostate shows nuclear and cytoplasmic positivity in glandular cells.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy FNTA polyclonal antibody now

Add to cart