Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31599 |
Product name: | CTSB polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human CTSB. |
Isotype: | IgG |
Gene id: | 1508 |
Gene name: | CTSB |
Gene alias: | APPS|CPSB |
Gene description: | cathepsin B |
Immunogen: | Recombinant protein corresponding to human CTSB. |
Immunogen sequence/protein sequence: | DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA |
Protein accession: | P07858 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells. |
Applications: | IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | Heterogeneity in signaling pathways of gastroenteropancreatic neuroendocrine tumors: a critical look at notch signaling pathway.Wang H, Chen Y, Fernandez-Del Castillo C, Yilmaz O, Deshpande V. Mod Pathol. 2013 Jan;26(1):139-47. |