View larger

SCRN1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCRN1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P,IF

More info about SCRN1 polyclonal antibody

Brand: Abnova
Reference: PAB31582
Product name: SCRN1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SCRN1
Isotype: IgG
Gene id: 9805
Gene name: SCRN1
Gene alias: KIAA0193|SES1
Gene description: secernin 1
Immunogen: Recombinant protein corresponding to human SCRN1.
Immunogen sequence/protein sequence: VKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKAHEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVD
Protein accession: Q12765
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB31582-48-51-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with SCRN1 polyclonal antibody (Cat # PAB31582) shows moderate cytoplasmic positivity in neuronal cells.
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SCRN1 polyclonal antibody now

Add to cart