Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NFATC2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about NFATC2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31580 |
| Product name: | NFATC2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human NFATC2 |
| Isotype: | IgG |
| Gene id: | 4773 |
| Gene name: | NFATC2 |
| Gene alias: | KIAA0611|NFAT1|NFATP |
| Gene description: | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 |
| Immunogen: | Recombinant protein corresponding to human NFATC2. |
| Immunogen sequence/protein sequence: | GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN |
| Protein accession: | Q13469 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with NFATC2 polyclonal antibody (Cat # PAB31580) shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Epithelial calcineurin controls microbiota-dependent intestinal tumor development.Peuker K, Muff S, Wang J, Kunzel S, Bosse E, Zeissig Y, Luzzi G, Basic M, Strigli A, Ulbricht A, Kaser A, Arlt A, Chavakis T, van den Brink GR, Schafmayer C, Egberts JH, Becker T, Bianchi ME, Bleich A, Rocken C, Hampe J, Schreiber S, Baines JF, Blumberg RS, Zeissig S. Nat Med. 2016 May;22(5):506-15. doi: 10.1038/nm.4072. Epub 2016 Apr 4. |