Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NCAM2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about NCAM2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31563 |
| Product name: | NCAM2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human NCAM2 |
| Isotype: | IgG |
| Gene id: | 4685 |
| Gene name: | NCAM2 |
| Gene alias: | MGC51008|NCAM21 |
| Gene description: | neural cell adhesion molecule 2 |
| Immunogen: | Recombinant protein corresponding to human NCAM2. |
| Immunogen sequence/protein sequence: | NVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPY |
| Protein accession: | O15394 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human caudate nucleus with NCAM2 polyclonal antibody (Cat # PAB31563) shows positivity in neuronal processes. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Human skin-derived stem cells as a novel cell source for in vitro hepatotoxicity screening of pharmaceuticals.Rodrigues RM, De Kock J, Branson S, Vinken M, Meganathan K, Chaudhari U, Sachinidis A, Govaere O, Roskams T, De Boe V, Vanhaecke T, Rogiers V. Stem Cells Dev. 2014 Jan 1;23(1):44-55. doi: 10.1089/scd.2013.0157. Epub 2013 Sep 21. |