View larger

LAD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about LAD1 polyclonal antibody

Brand: Abnova
Reference: PAB31555
Product name: LAD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human LAD1
Isotype: IgG
Gene id: 3898
Gene name: LAD1
Gene alias: LadA|MGC10355
Gene description: ladinin 1
Immunogen: Recombinant protein corresponding to human LAD1.
Immunogen sequence/protein sequence: EEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKTSISEKVLASEKTSLSEKIAVSEKRNSSEKKSVLEKTSVSEKSLAP
Protein accession: O00515
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31555-48-37-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human gall bladder with LAD1 polyclonal antibody (Cat # PAB31555) shows strong luminal membranous and cytoplasmic positivity in glandular cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy LAD1 polyclonal antibody now

Add to cart