View larger

DMRT1 polyclonal antibody

PAB31552_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DMRT1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about DMRT1 polyclonal antibody

Brand: Abnova
Reference: PAB31552
Product name: DMRT1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human DMRT1
Isotype: IgG
Gene id: 1761
Gene name: DMRT1
Gene alias: DMT1
Gene description: doublesex and mab-3 related transcription factor 1
Immunogen: Recombinant protein corresponding to human DMRT1.
Immunogen sequence/protein sequence: LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
Protein accession: Q9Y5R6
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31552-48-12-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with DMRT1 polyclonal antibody (Cat # PAB31552) shows strong nuclear positivity in fraction of cells in seminiferous ducts.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice
Publications: The human testis-specific proteome defined by transcriptomics and antibody-based profiling.Djureinovic D, Fagerberg L, Hallstrom B, Danielsson A, Lindskog C, Uhlen M, Ponten F.
Mol Hum Reprod. 2014 Jun;20(6):476-88. doi: 10.1093/molehr/gau018. Epub 2014 Mar 5.

Reviews

Buy DMRT1 polyclonal antibody now

Add to cart