View larger

KRT20 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KRT20 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,IHC-P

More info about KRT20 polyclonal antibody

Brand: Abnova
Reference: PAB31545
Product name: KRT20 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human KRT20
Isotype: IgG
Gene id: 54474
Gene name: KRT20
Gene alias: CD20|CK20|K20|KRT21|MGC35423
Gene description: keratin 20
Immunogen: Recombinant protein corresponding to human KRT20.
Immunogen sequence/protein sequence: MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
Protein accession: P35900
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31545-48-7-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with KRT20 polyclonal antibody (Cat # PAB31545) shows strong cytoplasmic and membranous positivity in glandular cells.
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy KRT20 polyclonal antibody now

Add to cart