Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31542 |
Product name: | PAGE4 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human PAGE4 |
Isotype: | IgG |
Gene id: | 9506 |
Gene name: | PAGE4 |
Gene alias: | FLJ35184|GAGE-9|GAGEC1|JM-27|JM27|PAGE-1|PAGE-4 |
Gene description: | P antigen family, member 4 (prostate associated) |
Immunogen: | Recombinant protein corresponding to human PAGE4. |
Immunogen sequence/protein sequence: | DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP |
Protein accession: | O60829 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with PAGE4 polyclonal antibody (Cat # PAB31542) shows strong cytoplasmic and nuclear positivity in a subset of trophoblastic cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | Evaluation of protein biomarkers of prostate cancer aggressiveness.Rizzardi AE, Rosener NK, Koopmeiners JS, Isaksson Vogel R, Metzger GJ, Forster CL, Marston LO, Tiffany JR, McCarthy JB, Turley EA, Warlick CA, Henriksen JC, Schmechel SC. BMC Cancer. 2014 Apr 5;14:244. doi: 10.1186/1471-2407-14-244. |