Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KRT76 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about KRT76 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31531 |
| Product name: | KRT76 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human KRT76 |
| Isotype: | IgG |
| Gene id: | 51350 |
| Gene name: | KRT76 |
| Gene alias: | HUMCYT2A|KRT2B|KRT2P |
| Gene description: | keratin 76 |
| Immunogen: | Recombinant protein corresponding to human KRT76. |
| Immunogen sequence/protein sequence: | SGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGSSSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK |
| Protein accession: | Q01546 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with KRT76 polyclonal antibody (Cat # PAB31531) shows strong positivity in stratum corneum. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Keratin 76 is required for tight junction function and maintenance of the skin barrier.DiTommaso T, Cottle DL, Pearson HB, Schluter H, Kaur P, Humbert PO, Smyth IM. PLoS Genet. 2014 Oct 23;10(10):e1004706. doi: 10.1371/journal.pgen.1004706. eCollection 2014 Oct. |