View larger

BAG4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BAG4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about BAG4 polyclonal antibody

Brand: Abnova
Reference: PAB31526
Product name: BAG4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human BAG4
Isotype: IgG
Gene id: 9530
Gene name: BAG4
Gene alias: BAG-4|SODD
Gene description: BCL2-associated athanogene 4
Immunogen: Recombinant protein corresponding to human BAG4.
Immunogen sequence/protein sequence: VHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQ
Protein accession: O95429
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31526-48-258-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum with BAG4 polyclonal antibody (Cat # PAB31526) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BAG4 polyclonal antibody now

Add to cart