Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,WB-Tr |
Brand: | Abnova |
Reference: | PAB31524 |
Product name: | CDR2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human CDR2 |
Isotype: | IgG |
Gene id: | 1039 |
Gene name: | CDR2 |
Gene alias: | CDR62|Yo |
Gene description: | cerebellar degeneration-related protein 2, 62kDa |
Immunogen: | Recombinant protein corresponding to human CDR2. |
Immunogen sequence/protein sequence: | GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV |
Protein accession: | Q01850 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with CDR2 polyclonal antibody (Cat # PAB31524) shows nuclear positivity in neurons. |
Applications: | IHC-P,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | CDR2L Antibodies: A New Player in Paraneoplastic Cerebellar Degeneration.Eichler TW, Totland C, Haugen M, Qvale TH, Mazengia K, Storstein A, Haukanes BI, Vedeler CA. PLoS One. 2013 Jun 18;8(6):e66002. doi: 10.1371/journal.pone.0066002. Print 2013. |