Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ti,IHC-P |
Brand: | Abnova |
Reference: | PAB31507 |
Product name: | ACACB polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human ACACB. |
Isotype: | IgG |
Gene id: | 32 |
Gene name: | ACACB |
Gene alias: | ACC2|ACCB|HACC275 |
Gene description: | acetyl-Coenzyme A carboxylase beta |
Immunogen: | Recombinant protein corresponding to human ACACB. |
Immunogen sequence/protein sequence: | ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS |
Protein accession: | O00763 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human soft tissue with ACACB polyclonal antibody (Cat # PAB31507) shows strong cytoplasmic and membranous positivity in adipocytes. |
Applications: | WB-Ti,IHC-P |
Shipping condition: | Dry Ice |
Publications: | An ACACB variant implicated in diabetic nephropathy associates with body mass index and gene expression in obese subjects.Ma L, Murea M, Snipes JA, Marinelarena A, Kruger J, Hicks PJ, Langberg KA, Bostrom MA, Cooke JN, Suzuki D, Babazono T, Uzu T, Tang SC, Mondal AK, Sharma NK, Kobes S, Antinozzi PA, Davis M, Das SK, Rasouli N, Kern PA, Shores NJ, Rudel LL, Bluher M, Stumvoll M, Bowden DW, Maeda S, Parks JS, Kovacs P, Hanson RL, Baier LJ, Elbein SC, Freedman BI. PLoS One. 2013;8(2):e56193. doi: 10.1371/journal.pone.0056193. Epub 2013 Feb 27. |