Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31502 |
Product name: | PTGES polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human PTGES. |
Isotype: | IgG |
Gene id: | 9536 |
Gene name: | PTGES |
Gene alias: | MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1 |
Gene description: | prostaglandin E synthase |
Immunogen: | Recombinant protein corresponding to human PTGES. |
Immunogen sequence/protein sequence: | ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM |
Protein accession: | O14684 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with PTGES polyclonal antibody (Cat # PAB31502) shows cytoplasmic positivity in a subset of trophoblastic cells. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | Active smoking increases microsomal PGE2-synthase-1/PGE-receptor-4 axis in human abdominal aortic aneurysms.Dilme JF, Sola-Villa D, Bellmunt S, Romero JM, Escudero JR, Camacho M, Vila L. Mediators Inflamm. 2014;2014:316150. doi: 10.1155/2014/316150. Epub 2014 Apr 30. |