View larger

TICAM1 polyclonal antibody

PAB31491_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TICAM1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TICAM1 polyclonal antibody

Brand: Abnova
Reference: PAB31491
Product name: TICAM1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human TICAM1.
Isotype: IgG
Gene id: 148022
Gene name: TICAM1
Gene alias: MGC35334|PRVTIRB|TICAM-1|TRIF
Gene description: toll-like receptor adaptor molecule 1
Immunogen: Recombinant protein corresponding to human TICAM1.
Immunogen sequence/protein sequence: AFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHL
Protein accession: Q8IUC6
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31491-48-2-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with TICAM1 polyclonal antibody (Cat # PAB31491) shows strong cytoplasmic positivity in cells in tubules.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TICAM1 polyclonal antibody now

Add to cart