Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAMKK2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,IHC-P,IF |
More info about CAMKK2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31486 |
| Product name: | CAMKK2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human CAMKK2. |
| Isotype: | IgG |
| Gene id: | 10645 |
| Gene name: | CAMKK2 |
| Gene alias: | CAMKK|CAMKKB|KIAA0787|MGC15254 |
| Gene description: | calcium/calmodulin-dependent protein kinase kinase 2, beta |
| Immunogen: | Recombinant protein corresponding to amino acids 2-137 of human CAMKK2. |
| Immunogen sequence/protein sequence: | SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS |
| Protein accession: | Q96RR4 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green. |
| Applications: | WB-Ti,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | c-Myc Antagonises the Transcriptional Activity of the Androgen Receptor in Prostate Cancer Affecting Key Gene Networks.Barfeld SJ, Urbanucci A, Itkonen HM, Fazli L, Hicks JL, Thiede B, Rennie PS, Yegnasubramanian S, DeMarzo AM, Mills IG. EBioMedicine. 2017 Apr;18:83-93. doi: 10.1016/j.ebiom.2017.04.006. Epub 2017 Apr 5. |