View larger

STK11 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STK11 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about STK11 polyclonal antibody

Brand: Abnova
Reference: PAB31473
Product name: STK11 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human STK11.
Isotype: IgG
Gene id: 6794
Gene name: STK11
Gene alias: LKB1|PJS
Gene description: serine/threonine kinase 11
Immunogen: Recombinant protein corresponding to human STK11.
Immunogen sequence/protein sequence: DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ
Protein accession: Q15831
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31473-48-12-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with STK11 polyclonal antibody (Cat # PAB31473) shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice
Publications: Loss of LKB1 in high-grade endometrial carcinoma: LKB1 is a novel transcriptional target of p53.Co NN, Iglesias D, Celestino J, Kwan SY, Mok SC, Schmandt R, Lu KH.
Cancer. 2014 Nov 15;120(22):3457-68. doi: 10.1002/cncr.28854. Epub 2014 Jul 16.

Reviews

Buy STK11 polyclonal antibody now

Add to cart