Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DEFA5 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,IHC-P |
More info about DEFA5 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31461 |
| Product name: | DEFA5 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human DEFA5. |
| Isotype: | IgG |
| Gene id: | 1670 |
| Gene name: | DEFA5 |
| Gene alias: | DEF5|HD-5|MGC129728 |
| Gene description: | defensin, alpha 5, Paneth cell-specific |
| Immunogen: | Recombinant protein corresponding to human DEFA5. |
| Immunogen sequence/protein sequence: | ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR |
| Protein accession: | Q01523 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with DEFA5 polyclonal antibody (Cat # PAB31461) shows strong cytoplasmic positivity in Paneth cells. |
| Applications: | WB-Ti,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Gene expression profiling of metaplastic lineages identifies CDH17 as a prognostic marker in early stage gastric cancer.Lee HJ, Nam KT, Park HS, Kim MA, Lafleur BJ, Aburatani H, Yang HK, Kim WH, Goldenring JR. Gastroenterology. 2010 Jul;139(1):213-25.e3. doi: 10.1053/j.gastro.2010.04.008. Epub 2010 Apr 13. |