Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,WB-Tr |
Brand: | Abnova |
Reference: | PAB31455 |
Product name: | SCNN1B polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human SCNN1B. |
Isotype: | IgG |
Gene id: | 6338 |
Gene name: | SCNN1B |
Gene alias: | ENaCb|ENaCbeta|SCNEB |
Gene description: | sodium channel, nonvoltage-gated 1, beta |
Immunogen: | Recombinant protein corresponding to human SCNN1B. |
Immunogen sequence/protein sequence: | GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS |
Protein accession: | P51168 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human small intestine with SCNN1B polyclonal antibody (Cat # PAB31455) shows cytoplasmic positivity in glandular cells. |
Applications: | IHC-P,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma.Baras AS, Gandhi N, Munari E, Faraj S, Shultz L, Marchionni L, Schoenberg M, Hahn N, Hoque M, Berman D, Bivalacqua TJ, Netto G. PLoS One. 2015 Jul 31;10(7):e0131245. doi: 10.1371/journal.pone.0131245. eCollection 2015. |