Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALDH3A2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P |
More info about ALDH3A2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31451 |
| Product name: | ALDH3A2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human ALDH3A2. |
| Isotype: | IgG |
| Gene id: | 224 |
| Gene name: | ALDH3A2 |
| Gene alias: | ALDH10|DKFZp686E23276|FALDH|FLJ20851|SLS |
| Gene description: | aldehyde dehydrogenase 3 family, member A2 |
| Immunogen: | Recombinant protein corresponding to human ALDH3A2. |
| Immunogen sequence/protein sequence: | SHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKE |
| Protein accession: | P51648 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human adrenal gland with ALDH3A2 polyclonal antibody (Cat # PAB31451) shows strong cytoplasmic positivity in cortical cells. |
| Applications: | WB,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Comparative analysis of proteome and transcriptome variation in mouse.Ghazalpour A, Bennett B, Petyuk VA, Orozco L, Hagopian R, Mungrue IN, Farber CR, Sinsheimer J, Kang HM, Furlotte N, Park CC, Wen PZ, Brewer H, Weitz K, Camp DG II, Pan C, Yordanova R, Neuhaus I, Tilford C, Siemers N, Gargalovic P, Eskin E, Kirchgessner T, Smith DJ, Smith RD, Lusis AJ. PLoS Genet. 2011 Jun;7(6):e1001393. doi: 10.1371/journal.pgen.1001393. Epub 2011 Jun 9. |