View larger

CYBRD1 polyclonal antibody

PAB31449_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYBRD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about CYBRD1 polyclonal antibody

Brand: Abnova
Reference: PAB31449
Product name: CYBRD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CYBRD1.
Isotype: IgG
Gene id: 79901
Gene name: CYBRD1
Gene alias: DCYTB|FLJ23462|FRRS3
Gene description: cytochrome b reductase 1
Immunogen: Recombinant protein corresponding to human CYBRD1.
Immunogen sequence/protein sequence: VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM
Protein accession: Q53TN4
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31449-48-7-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with CYBRD1 polyclonal antibody (Cat # PAB31449) shows strong cytoplasmic and membranous positivity in glandular cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice
Publications: DCYTB is a predictor of outcome in breast cancer that functions via iron-independent mechanisms.Lemler DJ, Lynch ML, Tesfay L, Deng Z, Paul BT, Wang X, Hegde P, Manz DH, Torti SV, Torti FM.
Breast Cancer Res. 2017 Mar 7;19(1):25. doi: 10.1186/s13058-017-0814-9.

Reviews

Buy CYBRD1 polyclonal antibody now

Add to cart