Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ti,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31444 |
Product name: | LRRK2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human LRRK2. |
Isotype: | IgG |
Gene id: | 120892 |
Gene name: | LRRK2 |
Gene alias: | AURA17|DARDARIN|PARK8|RIPK7|ROCO2 |
Gene description: | leucine-rich repeat kinase 2 |
Immunogen: | Recombinant protein corresponding to human LRRK2. |
Immunogen sequence/protein sequence: | VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL |
Protein accession: | Q5S007 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with LRRK2 polyclonal antibody (Cat # PAB31444) shows strong granular cytoplasmic positivity in cells in tubules. |
Applications: | WB-Ti,IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | Identification of TMEM230 mutations in familial Parkinson's disease.Deng HX, Shi Y, Yang Y, Ahmeti KB, Miller N, Huang C, Cheng L, Zhai H, Deng S, Nuytemans K, Corbett NJ, Kim MJ, Deng H, Tang B, Yang Z, Xu Y, Chan P, Huang B, Gao XP, Song Z, Liu Z, Fecto F, Siddique N, Foroud T, Jankovic J, Ghetti B, Nicholson DA, Krainc D, Melen O, Vance JM, Pericak-Vance MA, Ma YC, Rajput AH, Siddique T. Nat Genet. 2016 Jul;48(7):733-9. doi: 10.1038/ng.3589. Epub 2016 Jun 6. |