Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB-Ce,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31443 |
Product name: | LXN polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human LXN. |
Isotype: | IgG |
Gene id: | 56925 |
Gene name: | LXN |
Gene alias: | ECI|TCI |
Gene description: | latexin |
Immunogen: | Recombinant protein corresponding to human LXN. |
Immunogen sequence/protein sequence: | MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTF |
Protein accession: | Q9BS40 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with LXN polyclonal antibody (Cat # PAB31443) shows strong cytoplasmic and nuclear positivity in glandular cells. |
Applications: | WB-Ce,IHC-P,IF |
Shipping condition: | Dry Ice |
Publications: | The hematopoietic stem cell regulatory gene latexin has tumor-suppressive properties in malignant melanoma.Muthusamy V, Premi S, Soper C, Platt J, Bosenberg M. J Invest Dermatol. 2013 Jul;133(7):1827-33. doi: 10.1038/jid.2013.48. Epub 2013 Jan 30. |