Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31435 |
Product name: | NLRP3 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human NLRP3. |
Isotype: | IgG |
Gene id: | 114548 |
Gene name: | NLRP3 |
Gene alias: | AGTAVPRL|AII|AII/AVP|AVP|C1orf7|CIAS1|CLR1.1|FCAS|FCU|FLJ95925|MWS|NALP3|PYPAF1 |
Gene description: | NLR family, pyrin domain containing 3 |
Immunogen: | Recombinant protein corresponding to human NLRP3. |
Immunogen sequence/protein sequence: | FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR |
Protein accession: | Q96P20 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with NLRP3 polyclonal antibody (Cat # PAB31435) shows moderate cytoplasmic positivity in germinal and non-germinal center cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | Inflammasome-dependent caspase-1 activation in cervical epithelial cells stimulates growth of the intracellular pathogen Chlamydia trachomatis.Abdul-Sater AA, Koo E, Hacker G, Ojcius DM. J Biol Chem. 2009 Sep 25;284(39):26789-96. doi: 10.1074/jbc.M109.026823. Epub 2009 Jul 31. |