Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ITGA6 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about ITGA6 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31433 |
| Product name: | ITGA6 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human ITGA6. |
| Isotype: | IgG |
| Gene id: | 3655 |
| Gene name: | ITGA6 |
| Gene alias: | CD49f|DKFZp686J01244|FLJ18737|ITGA6B|VLA-6 |
| Gene description: | integrin, alpha 6 |
| Immunogen: | Recombinant protein corresponding to human ITGA6. |
| Immunogen sequence/protein sequence: | APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS |
| Protein accession: | P23229 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with ITGA6 polyclonal antibody (Cat # PAB31433) shows strong membranous positivity in trophoblastic cells. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Multiplex flow cytometry barcoding and antibody arrays identify surface antigen profiles of primary and metastatic colon cancer cell lines.Sukhdeo K, Paramban RI, Vidal JG, Elia J, Martin J, Rivera M, Carrasco DR, Jarrar A, Kalady MF, Carson CT, Balderas R, Hjelmeland AB, Lathia JD, Rich JN. PLoS One. 2013;8(1):e53015. doi: 10.1371/journal.pone.0053015. Epub 2013 Jan 7. |