Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NRCAM polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about NRCAM polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31432 |
| Product name: | NRCAM polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human NRCAM. |
| Isotype: | IgG |
| Gene id: | 4897 |
| Gene name: | NRCAM |
| Gene alias: | KIAA0343|MGC138845|MGC138846 |
| Gene description: | neuronal cell adhesion molecule |
| Immunogen: | Recombinant protein corresponding to human NRCAM. |
| Immunogen sequence/protein sequence: | REDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTPIIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQC |
| Protein accession: | Q92823 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with NRCAM polyclonal antibody (Cat # PAB31432) shows distinct positivity in neuropil. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Differential expression of neural markers in KIT and PDGFRA wild-type gastrointestinal stromal tumours.Pantaleo MA, Astolfi A, Nannini M, Ceccarelli C, Formica S, Santini D, Heinrich MC, Corless C, Dei Tos AP, Paterini P, Catena F, Maleddu A, Saponara M, Di Battista M, Biasco G. Histopathology. 2011 Dec;59(6):1071-80. doi: 10.1111/j.1365-2559.2011.04071.x. |