Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GDF15 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P,IF |
More info about GDF15 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31426 |
| Product name: | GDF15 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human GDF15. |
| Isotype: | IgG |
| Gene id: | 9518 |
| Gene name: | GDF15 |
| Gene alias: | GDF-15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB |
| Gene description: | growth differentiation factor 15 |
| Immunogen: | Recombinant protein corresponding to human GDF15. |
| Immunogen sequence/protein sequence: | LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL |
| Protein accession: | Q99988 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with GDF15 polyclonal antibody (Cat # PAB31426) shows strong cytoplasmic positivity in trophoblastic cells. |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | GDF-15 contributes to proliferation and immune escape of malignant gliomas.Roth P, Junker M, Tritschler I, Mittelbronn M, Dombrowski Y, Breit SN, Tabatabai G, Wick W, Weller M, Wischhusen J. Clin Cancer Res. 2010 Aug 1;16(15):3851-9. doi: 10.1158/1078-0432.CCR-10-0705. Epub 2010 Jun 9. |