Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF,WB-Tr |
Brand: | Abnova |
Reference: | PAB31424 |
Product name: | SIRT2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human SIRT2. |
Isotype: | IgG |
Gene id: | 22933 |
Gene name: | SIRT2 |
Gene alias: | SIR2|SIR2L|SIR2L2 |
Gene description: | sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae) |
Immunogen: | Recombinant protein corresponding to human SIRT2. |
Immunogen sequence/protein sequence: | KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL |
Protein accession: | Q8IXJ6 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with SIRT2 polyclonal antibody (Cat # PAB31424) shows cytoplasmic positivity in nerve fibers. |
Applications: | IHC-P,IF,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | A chromatin modifier genetic screen identifies SIRT2 as a modulator of response to targeted therapies through the regulation of MEK kinase activity.Bajpe PK, Prahallad A, Horlings H, Nagtegaal I, Beijersbergen R, Bernards R. Oncogene. 2015 Jan 22;34(4):531-6. doi: 10.1038/onc.2013.588. Epub 2014 Jan 27. |