View larger

CD276 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD276 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about CD276 polyclonal antibody

Brand: Abnova
Reference: PAB31416
Product name: CD276 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human CD276.
Isotype: IgG
Gene id: 80381
Gene name: CD276
Gene alias: B7-H3|B7H3
Gene description: CD276 molecule
Immunogen: Recombinant protein corresponding to human CD276.
Immunogen sequence/protein sequence: YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Protein accession: Q5ZPR3
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31416-48-33-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with CD276 polyclonal antibody (Cat # PAB31416) shows strong membrane and cytoplasmic positivity in glandular cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CD276 polyclonal antibody now

Add to cart