View larger

SIGLEC6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIGLEC6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about SIGLEC6 polyclonal antibody

Brand: Abnova
Reference: PAB31412
Product name: SIGLEC6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SIGLEC6.
Isotype: IgG
Gene id: 946
Gene name: SIGLEC6
Gene alias: CD327|CD33L|CD33L1|CDw327|OBBP1|SIGLEC-6
Gene description: sialic acid binding Ig-like lectin 6
Immunogen: Recombinant protein corresponding to human SIGLEC6.
Immunogen sequence/protein sequence: RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Protein accession: O43699
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31412-48-41-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with SIGLEC6 polyclonal antibody (Cat # PAB31412) shows moderate cytoplasmic ans membranous positivity in trophoblastic cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SIGLEC6 polyclonal antibody now

Add to cart