View larger

ATRN polyclonal antibody

PAB31409_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATRN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ATRN polyclonal antibody

Brand: Abnova
Reference: PAB31409
Product name: ATRN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human ATRN.
Isotype: IgG
Gene id: 8455
Gene name: ATRN
Gene alias: DPPT-L|KIAA0548|MGC126754|MGCA
Gene description: attractin
Immunogen: Recombinant protein corresponding to human ATRN.
Immunogen sequence/protein sequence: LLLSDILVFTSEQCDAHRSEAACLAAGPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWE
Protein accession: O75882
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31409-48-I6-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with ATRN polyclonal antibody (Cat # PAB31409) shows cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice
Publications: Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas.Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS.
Mol Cell Proteomics. 2010 Jun;9(6):1100-17. doi: 10.1074/mcp.M900398-MCP200. Epub 2010 Feb 1.

Reviews

Buy ATRN polyclonal antibody now

Add to cart