Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RPN2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about RPN2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31400 |
| Product name: | RPN2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human RPN2. |
| Isotype: | IgG |
| Gene id: | 6185 |
| Gene name: | RPN2 |
| Gene alias: | RIBIIR|RPN-II|RPNII|SWP1 |
| Gene description: | ribophorin II |
| Immunogen: | Recombinant protein corresponding to human RPN2. |
| Immunogen sequence/protein sequence: | SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE |
| Protein accession: | P04844 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human epididymis with RPN2 polyclonal antibody (Cat # PAB31400) shows strong cytoplasmic positivity in glandular cells. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas.Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS. Mol Cell Proteomics. 2010 Jun;9(6):1100-17. doi: 10.1074/mcp.M900398-MCP200. Epub 2010 Feb 1. |