View larger

RPN2 polyclonal antibody

PAB31400_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPN2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about RPN2 polyclonal antibody

Brand: Abnova
Reference: PAB31400
Product name: RPN2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human RPN2.
Isotype: IgG
Gene id: 6185
Gene name: RPN2
Gene alias: RIBIIR|RPN-II|RPNII|SWP1
Gene description: ribophorin II
Immunogen: Recombinant protein corresponding to human RPN2.
Immunogen sequence/protein sequence: SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE
Protein accession: P04844
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31400-48-301-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human epididymis with RPN2 polyclonal antibody (Cat # PAB31400) shows strong cytoplasmic positivity in glandular cells.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice
Publications: Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas.Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS.
Mol Cell Proteomics. 2010 Jun;9(6):1100-17. doi: 10.1074/mcp.M900398-MCP200. Epub 2010 Feb 1.

Reviews

Buy RPN2 polyclonal antibody now

Add to cart