Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF |
Brand: | Abnova |
Reference: | PAB31398 |
Product name: | MST1R polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human MST1R. |
Isotype: | IgG |
Gene id: | 4486 |
Gene name: | MST1R |
Gene alias: | CD136|CDw136|PTK8|RON |
Gene description: | macrophage stimulating 1 receptor (c-met-related tyrosine kinase) |
Immunogen: | Recombinant protein corresponding to human MST1R. |
Immunogen sequence/protein sequence: | EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP |
Protein accession: | Q04912 |
Form: | Liquid |
Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human vagina with MST1R polyclonal antibody (Cat # PAB31398) shows strong cytoplasmic positivity in squamous epithelial cells. |
Applications: | IHC-P,IF |
Shipping condition: | Dry Ice |