Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB31397 |
Product name: | S100A4 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human S100A4. |
Isotype: | IgG |
Gene id: | 6275 |
Gene name: | S100A4 |
Gene alias: | 18A2|42A|CAPL|FSP1|MTS1|P9KA|PEL98 |
Gene description: | S100 calcium binding protein A4 |
Immunogen: | Recombinant protein corresponding to human S100A4. |
Immunogen sequence/protein sequence: | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
Protein accession: | P26447 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with S100A4 polyclonal antibody (Cat # PAB31397) shows strong cytoplasmic positivity in bile duct cells. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |
Publications: | Decidual PTEN expression is required for trophoblast invasion in the mouse.Lague MN, Detmar J, Paquet M, Boyer A, Richards JS, Adamson SL, Boerboom D. Am J Physiol Endocrinol Metab. 2010 Dec;299(6):E936-46. doi: 10.1152/ajpendo.00255.2010. Epub 2010 Sep 21. |