Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ti,IHC-P |
Brand: | Abnova |
Reference: | PAB31392 |
Product name: | MAP1LC3A polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human MAP1LC3A. |
Isotype: | IgG |
Gene id: | 84557 |
Gene name: | MAP1LC3A |
Gene alias: | LC3|LC3A|MAP1ALC3|MAP1BLC3 |
Gene description: | microtubule-associated protein 1 light chain 3 alpha |
Immunogen: | Recombinant protein corresponding to human MAP1LC3A. |
Immunogen sequence/protein sequence: | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS |
Protein accession: | Q9H492 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MAP1LC3A polyclonal antibody (Cat # PAB31392) shows strong cytoplasmic and nuclear positivity in neuronal cells. |
Applications: | WB-Ti,IHC-P |
Shipping condition: | Dry Ice |
Publications: | Granulovacuolar degeneration (GVD) bodies of Alzheimer's disease (AD) resemble late-stage autophagic organelles.Funk KE, Mrak RE, Kuret J. Neuropathol Appl Neurobiol. 2011 Apr;37(3):295-306. doi: 10.1111/j.1365-2990.2010.01135.x. |