Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB31379 |
Product name: | SCG3 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human SCG3. |
Isotype: | IgG |
Gene id: | 29106 |
Gene name: | SCG3 |
Gene alias: | FLJ90833|SGIII |
Gene description: | secretogranin III |
Immunogen: | Recombinant protein corresponding to human SCG3. |
Immunogen sequence/protein sequence: | LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE |
Protein accession: | Q8WXD2 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus with SCG3 polyclonal antibody (Cat # PAB31379) shows cytoplasmic positivity in neurons. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |
Publications: | Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas.Leja J, Essaghir A, Essand M, Wester K, Oberg K, Totterman TH, Lloyd R, Vasmatzis G, Demoulin JB, Giandomenico V. Mod Pathol. 2009 Feb;22(2):261-72. doi: 10.1038/modpathol.2008.174. Epub 2008 Oct 24. |