View larger

SCG3 polyclonal antibody

PAB31379_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCG3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about SCG3 polyclonal antibody

Brand: Abnova
Reference: PAB31379
Product name: SCG3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human SCG3.
Isotype: IgG
Gene id: 29106
Gene name: SCG3
Gene alias: FLJ90833|SGIII
Gene description: secretogranin III
Immunogen: Recombinant protein corresponding to human SCG3.
Immunogen sequence/protein sequence: LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
Protein accession: Q8WXD2
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31379-48-223-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus with SCG3 polyclonal antibody (Cat # PAB31379) shows cytoplasmic positivity in neurons.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice
Publications: Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas.Leja J, Essaghir A, Essand M, Wester K, Oberg K, Totterman TH, Lloyd R, Vasmatzis G, Demoulin JB, Giandomenico V.
Mod Pathol. 2009 Feb;22(2):261-72. doi: 10.1038/modpathol.2008.174. Epub 2008 Oct 24.

Reviews

Buy SCG3 polyclonal antibody now

Add to cart