Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB31375 |
Product name: | S100A1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human S100A1. |
Isotype: | IgG |
Gene id: | 6271 |
Gene name: | S100A1 |
Gene alias: | S100|S100-alpha|S100A |
Gene description: | S100 calcium binding protein A1 |
Immunogen: | Recombinant protein corresponding to human S100A1. |
Immunogen sequence/protein sequence: | GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
Protein accession: | P23297 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus with S100A1 polyclonal antibody (Cat # PAB31375) shows nuclear and cytoplasmic positivity in subsets of glial cells. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |
Publications: | CD300f immunoreceptor contributes to peripheral nerve regeneration by the modulation of macrophage inflammatory phenotype.Peluffo H, Solari-Saquieres P, Negro-Demontel ML, Francos-Quijorna I, Navarro X, Lopez-Vales R, Sayos J, Lago N. J Neuroinflammation. 2015 Aug 12;12:145. doi: 10.1186/s12974-015-0364-y. |