View larger

PRTN3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRTN3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about PRTN3 polyclonal antibody

Brand: Abnova
Reference: PAB31371
Product name: PRTN3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human PRTN3.
Isotype: IgG
Gene id: 5657
Gene name: PRTN3
Gene alias: ACPA|AGP7|C-ANCA|MBT|P29|PR-3
Gene description: proteinase 3
Immunogen: Recombinant protein corresponding to human PRTN3.
Immunogen sequence/protein sequence: PTQQHFSVAQVFLNNYDAENKLNDILLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGI
Protein accession: P24158
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31371-48-70-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human bone marrow with PRTN3 polyclonal antibody (Cat # PAB31371) shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRTN3 polyclonal antibody now

Add to cart