View larger

TEC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TEC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about TEC polyclonal antibody

Brand: Abnova
Reference: PAB31368
Product name: TEC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human TEC.
Isotype: IgG
Gene id: 7006
Gene name: TEC
Gene alias: MGC126760|MGC126762|PSCTK4
Gene description: tec protein tyrosine kinase
Immunogen: Recombinant protein corresponding to human TEC.
Immunogen sequence/protein sequence: SNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGL
Protein accession: P42680
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31368-48-10-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with TEC polyclonal antibody (Cat # PAB31368) shows strong cytoplasmic positivity in germinal and non-germinal center cells
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TEC polyclonal antibody now

Add to cart