Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ASAH1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about ASAH1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31359 |
| Product name: | ASAH1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human ASAH1. |
| Isotype: | IgG |
| Gene id: | 427 |
| Gene name: | ASAH1 |
| Gene alias: | AC|ASAH|FLJ21558|FLJ22079|PHP|PHP32 |
| Gene description: | N-acylsphingosine amidohydrolase (acid ceramidase) 1 |
| Immunogen: | Recombinant protein corresponding to human ASAH1. |
| Immunogen sequence/protein sequence: | ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF |
| Protein accession: | Q13510 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with ASAH1 polyclonal antibody (Cat # PAB31359) shows strong granular cytoplasmic positivity in cardiomyocytes. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Acid ceramidase (ASAH1) represses steroidogenic factor 1-dependent gene transcription in H295R human adrenocortical cells by binding to the receptor.Lucki NC, Li D, Bandyopadhyay S, Wang E, Merrill AH, Sewer MB. Mol Cell Biol. 2012 Nov;32(21):4419-31. doi: 10.1128/MCB.00378-12. Epub 2012 Aug 27. |