Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB31359 |
Product name: | ASAH1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human ASAH1. |
Isotype: | IgG |
Gene id: | 427 |
Gene name: | ASAH1 |
Gene alias: | AC|ASAH|FLJ21558|FLJ22079|PHP|PHP32 |
Gene description: | N-acylsphingosine amidohydrolase (acid ceramidase) 1 |
Immunogen: | Recombinant protein corresponding to human ASAH1. |
Immunogen sequence/protein sequence: | ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF |
Protein accession: | Q13510 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with ASAH1 polyclonal antibody (Cat # PAB31359) shows strong granular cytoplasmic positivity in cardiomyocytes. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |
Publications: | Acid ceramidase (ASAH1) represses steroidogenic factor 1-dependent gene transcription in H295R human adrenocortical cells by binding to the receptor.Lucki NC, Li D, Bandyopadhyay S, Wang E, Merrill AH, Sewer MB. Mol Cell Biol. 2012 Nov;32(21):4419-31. doi: 10.1128/MCB.00378-12. Epub 2012 Aug 27. |