Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB31355 |
Product name: | H6PD polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human H6PD. |
Isotype: | IgG |
Gene id: | 9563 |
Gene name: | H6PD |
Gene alias: | DKFZp686A01246|G6PDH|GDH|MGC87643 |
Gene description: | hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) |
Immunogen: | Recombinant protein corresponding to human H6PD. |
Immunogen sequence/protein sequence: | APMPSDFQVLRAKYRESPLVSAWSEELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQQLATAHYGFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLLQHVRIPYYNIHP |
Protein accession: | O95479 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with H6PD polyclonal antibody (Cat # PAB31355) shows moderate cytoplasmic positivity in hepatocytes. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |