View larger

BIN1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BIN1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about BIN1 polyclonal antibody

Brand: Abnova
Reference: PAB31354
Product name: BIN1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human BIN1.
Isotype: IgG
Gene id: 274
Gene name: BIN1
Gene alias: AMPH2|AMPHL|DKFZp547F068|MGC10367|SH3P9
Gene description: bridging integrator 1
Immunogen: Recombinant protein corresponding to human BIN1.
Immunogen sequence/protein sequence: VTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHH
Protein accession: O00499
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31354-48-51-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with BIN1 polyclonal antibody (Cat # PAB31354) shows strong nuclear and cytoplasmic positivity in neuronal cells and glial cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BIN1 polyclonal antibody now

Add to cart