View larger

HTR1E polyclonal antibody

PAB31352_100 uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTR1E polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about HTR1E polyclonal antibody

Brand: Abnova
Reference: PAB31352
Product name: HTR1E polyclonal antibody
Product description: Rabbit polyclonal antibody raised against partial recombinant human HTR1E.
Isotype: IgG
Gene id: 3354
Gene name: HTR1E
Gene alias: 5-HT1E
Gene description: 5-hydroxytryptamine (serotonin) receptor 1E
Immunogen: Recombinant protein corresponding to human HTR1E.
Immunogen sequence/protein sequence: RIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRER
Protein accession: P28566
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB31352-48-51-1.jpg
Application image note: Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with HTR1E polyclonal antibody (Cat # PAB31352) shows strong nuclear positivity in neuronal cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HTR1E polyclonal antibody now

Add to cart